PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v2657800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YA
Protein Properties Length: 303aa    MW: 33151.2 Da    PI: 9.0639
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v2657800.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA105.16.1e-33140196158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep+YVNaKQy++Il+RRq Rakle+++kl +k+rkpylheSRh hA++R+RgsgGrF
  Lj3g3v2657800.1 140 EEPIYVNAKQYHAILRRRQYRAKLEAQNKL-AKNRKPYLHESRHLHAMKRARGSGGRF 196
                      69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.4E-37138199IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.689139199IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.4E-28141196IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.1E-24142164IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860144164IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.1E-24173196IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MKMSSLPQQC HQTKPLSLKF QDQDSCSTQS TGQSYPKVGS AQSGQISVQY SNSSDCSTVS  60
KTGEESVEGF IRSSAVTRDF TFPPSQLSYN QSLANIAFHH AEPCFSGLLA APYGPQPNIH  120
HAQLIGMAPV RIPLPLDLCE EPIYVNAKQY HAILRRRQYR AKLEAQNKLA KNRKPYLHES  180
RHLHAMKRAR GSGGRFLNTK KLQESKLTSK NHGFGASNCT QLNLSGNMSE SEVGRVENYG  240
DGVSATTCSD VTSGSNSDCI LKQQELEFRL CGYPSHIGRN MQGYAANMGS GGGANQHHLS  300
VLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-23139200162NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.205050.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004510428.11e-154PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1
TrEMBLA0A0R0J5U31e-152A0A0R0J5U3_SOYBN; Uncharacterized protein
TrEMBLA0A151T9E01e-151A0A151T9E0_CAJCA; Nuclear transcription factor Y subunit A-3
STRINGGLYMA07G04050.51e-150(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101202541
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.11e-67nuclear factor Y, subunit A3